HORDB

ID: hor002130
Uniprot ID: P67970
Protein name: Insulin A chain
Gene name: INS
Organism: Gallus gallus (Chicken)
Family: Insulin family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Gallus (genus), Phasianinae (subfamily), Phasianidae (family), Galliformes (order), Galloanserae (superorder), Neognathae (infraclass), Aves (class), Coelurosauria, Theropoda, Saurischia, Dinosauria, Archosauria, Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0003407 neural retina development; GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007165 signal transduction; GO:0008283 cell population proliferation; GO:0010467 gene expression; GO:0010628 positive regulation of gene expression; GO:0043066 negative regulation of apoptotic process
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence: GIVEQCCHNTCSLYQLENYCN
Length: 21
Propeptide: MALWIRSLPLLALLVFSGPGTSYAAANQHLCGSHLVEALYLVCGERGFFYSPKARRDVEQPLVSSPLRGEAGVLPFQQEEYEKVKRGIVEQCCHNTCSLYQLENYCN
Signal peptide: MALWIRSLPLLALLVFSGPGTSYA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
Mechanism: NA
Cross BBB: NA
Target: INSR
Target Unid: A0A1D5P6T3
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor002130_AF2.pdb

hor002130_ESM.pdb

Mass:	279165	Formula:	C100H152N28O35S4
Absent amino acids:	ADFKMPRW	Common amino acids:	C
pI:	4.25	Basic residues:	1
Polar residues:	12	Hydrophobic residues:	4
Hydrophobicity:	-28.1	Boman Index:	-3067
Half-Life:	30 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	69.52
Instability Index:	2977.62	Extinction Coefficient cystines:	3230
Absorbance 280nm:	161.5